PD-L1/CD274 Rabbit pAb (APR23040N) APR23040N
Specifications
| 50µl / 100µl / 200µl |
Product info:
This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants.
Alternative names:
B7-H; B7H1; PDL1; PD-L1; PDCD1L1; PDCD1LG1; CD274
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Cell membrane, Endomembrane system, Single-pass type I membrane protein
Isotype:
IgG
Immunogen:
Recombinant fusion protein containing a sequence corresponding to amino acids 19-238 of human PD-L1/CD274 (NP_054862.1).
Positive control:
A-549, Mouse skeletal muscle, Mouse heart, Rat skeletal muscle, Rat heart
AA Sequence:
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Purification:
Affinity purification
Molecular weight:
Calculated MW: 20kDa/33kDa Observed MW: 40-50KDa
Form:
Liquid
Applications:
IHC (Human gastric cancer tissue, Human gastric mucosa, Human liver cancer, Homo sapiens) WB (Homo sapiens, Mus musculus) IF (Homo sapiens)
Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
