Skip to main content

Leading Biology

LeadingBiology

With experienced biologists, Leading Biology continuously optimizes the process and the quality assurance in manufacturing, dedicated to exploring and designing products on a higher level. The specialty in antibody engineering and synthetic biology make it possible to develop effective, convenient and simplified products with excellent performance in research. In national and international collaborations, their team of biologists has applied their experience and research results to the development of biological products to meet our customers’ different needs.

Leading Biology offers more than 30,000 self-developed antibodies & proteins, hundreds of ELISA kits, and proteins.

www.leadingbiology.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

KLRK1 Rabbit pAb (APR26280N) APR26280N



The add to cart button will appear once you select the values above

Specifications

50µl / 100µl / 200µl

Product info:

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. This gene encodes a member of the NKG2 family. The encoded transmembrane protein is characterized by a type II membrane orientation (has an extracellular C terminus) and the presence of a C-type lectin domain. It binds to a diverse family of ligands that include MHC class I chain-related A and B proteins and UL-16 binding proteins, where ligand-receptor interactions can result in the activation of NK and T cells. The surface expression of these ligands is important for the recognition of stressed cells by the immune system, and thus this protein and its ligands are therapeutic targets for the treatment of immune diseases and cancers. Read-through transcription exists between this gene and the upstream KLRC4 (killer cell lectin-like receptor subfamily C, member 4) family member in the same cluster.

Alternative names:

KLRK1; CD314; D12S2489E; KLR; NKG2-D; NKG2D

Species reactivity:

Human, Mouse

Host:

Rabbit

Cellular localisation:

Cell membrane, Single-pass type II membrane protein

Isotype:

IgG

Immunogen:

Recombinant fusion protein containing a sequence corresponding to amino acids 77-216 of human KLRK1 (NP_031386.2).

Positive control:

HepG2, BT-474, U-251MG

AA Sequence:

VFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Purification:

Affinity purification

Molecular weight:

Calculated MW: 25kDa Observed MW: 30kDa

Form:

Liquid

Applications:

WB (Capra hircus)

Dilution:

WB 1:500 - 1:2000

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com