IFITM1 Rabbit pAb (APR25449N) APR25449N
Specifications
| 50µl / 100µl / 200µl |
Product info:
IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2, Marburg virus (MARV, Ebola virus (EBOV, Dengue virus (DNV, West Nile virus (WNV, human immunodeficiency virus type 1 (HIV-1 and hepatitis C virus (HCV. Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV and SARS-CoV-2 S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration. Inhibits SARS-CoV-2 S protein-mediated syncytia formation. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation. In hepatocytes, IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation. IFITM2 and IFITM3 display anti-HCV activity that may complement the anti-HCV activity of IFITM1 by inhibiting the late stages of HCV entry, possibly in a coordinated manner by trapping the virion in the endosomal pathway and targeting it for degradation at the lysosome.
Alternative names:
IFITM1; 9-27; CD225; DSPA2a; IFI17; LEU13
Species reactivity:
Human, Mouse
Host:
Rabbit
Cellular localisation:
Cell membrane, Single-pass membrane protein
Isotype:
IgG
Immunogen:
A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human IFITM1 (NP_003632.3).
Positive control:
K-562
AA Sequence:
CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
Purification:
Affinity purification
Molecular weight:
Calculated MW: 13kDa Observed MW: 17kDa
Form:
Liquid
Applications:
WB (Homo sapiens)
Dilution:
WB 1:200 - 1:2000 IHC 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
