Skip to main content

Leading Biology

LeadingBiology

With experienced biologists, Leading Biology continuously optimizes the process and the quality assurance in manufacturing, dedicated to exploring and designing products on a higher level. The specialty in antibody engineering and synthetic biology make it possible to develop effective, convenient and simplified products with excellent performance in research. In national and international collaborations, their team of biologists has applied their experience and research results to the development of biological products to meet our customers’ different needs.

Leading Biology offers more than 30,000 self-developed antibodies & proteins, hundreds of ELISA kits, and proteins.

www.leadingbiology.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

NOTCH2 Rabbit pAb (APR17475N) APR17475N



The add to cart button will appear once you select the values above

Specifications

50µl / 100µl / 200µl

Product info:

This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play a role in vascular, renal and hepatic development. Two transcript variants encoding different isoforms have been found for this gene.

Alternative names:

NOTCH2; AGS2; HJCYS; hN2; notch 2

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Cell membrane, Cytoplasm, Nucleus, Single-pass type I membrane protein

Isotype:

IgG

Immunogen:

Recombinant fusion protein containing a sequence corresponding to amino acids 2242-2471 of human NOTCH2 (NP_077719.2).

Positive control:

293T, LO2, HeLa

AA Sequence:

SRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMYQIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMSEPPHNNMQVYA

Purification:

Affinity purification

Molecular weight:

Calculated MW: 265kDa Observed MW: 120kDa

Form:

Liquid

Applications:

IHC (Mus musculus)

Dilution:

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com