PCSK2 Rabbit pAb (APR28395N) APR28395N
Specifications
| 50µl / 100µl / 200µl |
Product info:
This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The protein undergoes an initial autocatalytic processing event and interacts with a neuroendocrine secretory protein in the ER, exits the ER and sorts to secretory granules, where it is cleaved and catalytically activated during intracellular transport. The encoded protease is packaged into and activated in dense core secretory granules and expressed in the neuroendocrine system and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. It functions in the proteolytic activation of polypeptide hormones and neuropeptides precursors. Single nucleotide polymorphisms in this gene may increase susceptibility to myocardial infarction and type 2 diabetes. This gene may also play a role in tumor development and progression. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Alternative names:
PCSK2; NEC 2; NEC-2; NEC2; PC2; SPC2
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Cytoplasmic vesicle, secretory vesicle
Isotype:
IgG
Immunogen:
Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human PCSK2 (NP_002585.2).
Positive control:
U-87MG, HL-60, Mouse brain, Mouse pancreas, Mouse liver, Rat liver
AA Sequence:
MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAA
Purification:
Affinity purification
Molecular weight:
Calculated MW: 66kDa/68kDa/70kDa Observed MW: 70kDa
Form:
Liquid
Applications:
Request info at info@sobekbio.com
Dilution:
WB 1:1000 - 1:2000
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
