FBXO11 Rabbit pAb (APR26308N) APR26308N
Specifications
| 50µl / 100µl / 200µl |
Product info:
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. It can function as an arginine methyltransferase that symmetrically dimethylates arginine residues, and it acts as an adaptor protein to mediate the neddylation of p53, which leads to the suppression of p53 function. This gene is known to be down-regulated in melanocytes from patients with vitiligo, a skin disorder that results in depigmentation. Polymorphisms in this gene are associated with chronic otitis media with effusion and recurrent otitis media (COME/ROM), a hearing loss disorder, and the knockout of the homologous mouse gene results in the deaf mouse mutant Jeff (Jf), a single gene model of otitis media. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Alternative names:
FBXO11; FBX11; PRMT9; UBR6; UG063H01; VIT1
Species reactivity:
Human, Mouse
Host:
Rabbit
Cellular localisation:
Chromosome, Nucleus
Isotype:
IgG
Immunogen:
Recombinant fusion protein containing a sequence corresponding to amino acids 688-927 of human FBXO11 (NP_001177203.1).
Positive control:
HeLa, Mouse spleen, Mouse ovary, Mouse lung
AA Sequence:
GILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPILRKNRIFDGFAAGIEITNHATATLEGNQIFNNRFGGLFLASGVNVTMKDNKIMNNQDAIEKAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN
Purification:
Affinity purification
Molecular weight:
Calculated MW: 23kDa/62kDa/65kDa/94kDa/103kDa/106kDa Observed MW: 130kDa
Form:
Liquid
Applications:
Request info at info@sobekbio.com
Dilution:
WB 1:500 - 1:2000 IF 1:20 - 1:100
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
