UBL4A Rabbit pAb (APR25445N) APR25445N
Specifications
| 50µl / 100µl / 200µl |
Product info:
As part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates in their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum. Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated and sorted to the proteasome. Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD, a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.
Alternative names:
UBL4A; DX254E; DXS254E; G6PD; GDX; GET5; MDY2; TMA24; UBL4
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Cytoplasm, cytosol
Isotype:
IgG
Immunogen:
Recombinant fusion protein containing a sequence corresponding to amino acids 1-157 of human UBL4A (NP_055050.1).
Positive control:
HeLa, A-549, U-87MG, Mouse brain, Mouse kidney
AA Sequence:
MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK
Purification:
Affinity purification
Molecular weight:
Calculated MW: 17kDa Observed MW: 14-16kDa
Form:
Liquid
Applications:
Request info at info@sobekbio.com
Dilution:
WB 1:200 - 1:1000 IP 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
