Skip to main content

Leading Biology

LeadingBiology

With experienced biologists, Leading Biology continuously optimizes the process and the quality assurance in manufacturing, dedicated to exploring and designing products on a higher level. The specialty in antibody engineering and synthetic biology make it possible to develop effective, convenient and simplified products with excellent performance in research. In national and international collaborations, their team of biologists has applied their experience and research results to the development of biological products to meet our customers’ different needs.

Leading Biology offers more than 30,000 self-developed antibodies & proteins, hundreds of ELISA kits, and proteins.

www.leadingbiology.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

UBL4A Rabbit pAb (APR25445N) APR25445N



The add to cart button will appear once you select the values above

Specifications

50µl / 100µl / 200µl

Product info:

As part of a cytosolic protein quality control complex, the BAG6/BAT3 complex, maintains misfolded and hydrophobic patches-containing proteins in a soluble state and participates in their proper delivery to the endoplasmic reticulum or alternatively can promote their sorting to the proteasome where they undergo degradation. The BAG6/BAT3 complex is involved in the post-translational delivery of tail-anchored/type II transmembrane proteins to the endoplasmic reticulum membrane. Recruited to ribosomes, it interacts with the transmembrane region of newly synthesized tail-anchored proteins and together with SGTA and ASNA1 mediates their delivery to the endoplasmic reticulum. Client proteins that cannot be properly delivered to the endoplasmic reticulum are ubiquitinated and sorted to the proteasome. Similarly, the BAG6/BAT3 complex also functions as a sorting platform for proteins of the secretory pathway that are mislocalized to the cytosol either delivering them to the proteasome for degradation or to the endoplasmic reticulum. The BAG6/BAT3 complex also plays a role in the endoplasmic reticulum-associated degradation (ERAD, a quality control mechanism that eliminates unwanted proteins of the endoplasmic reticulum through their retrotranslocation to the cytosol and their targeting to the proteasome. It maintains these retrotranslocated proteins in an unfolded yet soluble state condition in the cytosol to ensure their proper delivery to the proteasome.

Alternative names:

UBL4A; DX254E; DXS254E; G6PD; GDX; GET5; MDY2; TMA24; UBL4

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Cytoplasm, cytosol

Isotype:

IgG

Immunogen:

Recombinant fusion protein containing a sequence corresponding to amino acids 1-157 of human UBL4A (NP_055050.1).

Positive control:

HeLa, A-549, U-87MG, Mouse brain, Mouse kidney

AA Sequence:

MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK

Purification:

Affinity purification

Molecular weight:

Calculated MW: 17kDa Observed MW: 14-16kDa

Form:

Liquid

Applications:

Request info at info@sobekbio.com

Dilution:

WB 1:200 - 1:1000 IP 1:50 - 1:200

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com