RPL5 Rabbit pAb (APR24515N) APR24515N
Specifications
| 50µl / 100µl / 200µl |
Product info:
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18P family of ribosomal proteins. It is located in the cytoplasm. The protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The protein interacts specifically with the beta subunit of casein kinase II. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Alternative names:
RPL5; DBA6; L5; MSTP030; PPP1R135
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Cytoplasm, Nucleus, nucleolus
Isotype:
IgG
Immunogen:
Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human RPL5 (NP_000960.2).
Positive control:
HT-29, HepG2, Mouse brain, Mouse heart, Rat liver
AA Sequence:
MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNY
Purification:
Affinity purification
Molecular weight:
Calculated MW: 34kDa Observed MW: 34KDa
Form:
Liquid
Applications:
Request info at info@sobekbio.com
Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
