UBQLN4 Rabbit pAb (APR22454N) APR22454N
Specifications
| 50µl / 100µl / 200µl |
Product info:
Regulator of protein degradation that mediates the proteasomal targeting of misfolded, mislocalized or accumulated proteins. Acts by binding polyubiquitin chains of target proteins via its UBA domain and by interacting with subunits of the proteasome via its ubiquitin-like domain. Key regulator of DNA repair that represses homologous recombination repair: in response to DNA damage, recruited to sites of DNA damage following phosphorylation by ATM and acts by binding and removing ubiquitinated MRE11 from damaged chromatin, leading to MRE11 degradation by the proteasome. MRE11 degradation prevents homologous recombination repair, redirecting double-strand break repair toward non-homologous end joining (NHEJ. Specifically recognizes and binds mislocalized transmembrane-containing proteins and targets them to proteasomal degradation. Collaborates with DESI1/POST in the export of ubiquitinated proteins from the nucleus to the cytoplasm. Also plays a role in the regulation of the proteasomal degradation of non-ubiquitinated GJA1 (By similarity. Acts as an adapter protein that recruits UBQLN1 to the autophagy machinery. Mediates the association of UBQLN1 with autophagosomes and the autophagy-related protein LC3 (MAP1LC3A/B/C and may assist in the maturation of autophagosomes to autolysosomes by mediating autophagosome-lysosome fusion.
Alternative names:
UBQLN4; A1U; A1Up; C1orf6; CIP75; UBIN
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Nucleus, autophagosome, perinuclear region
Isotype:
IgG
Immunogen:
Recombinant fusion protein containing a sequence corresponding to amino acids 300-390 of human UBQLN4 (NP_064516.2).
Positive control:
BxPC-3, RD, SH-SY5Y, Mouse testis, Mouse thymus, Rat kidney
AA Sequence:
QFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQI
Purification:
Affinity purification
Molecular weight:
Calculated MW: 24kDa/63kDa Observed MW: 75KDa
Form:
Liquid
Applications:
Request info at info@sobekbio.com
Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
