HLA-B Rabbit pAb (APR19462N) APR19462N
Specifications
| 50µl / 100µl / 200µl |
Product info:
HLA-B belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exon 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-B alleles have been described.
Alternative names:
HLA-B; AS; B-4901; HLAB; Bw-47; Bw-50; SPDA1
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Membrane, Single-pass type I membrane protein
Isotype:
IgG
Immunogen:
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA-B (NP_005505.2).
Positive control:
U-251MG, Jurkat, HepG2, A-549, MCF7
AA Sequence:
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRE
Purification:
Affinity purification
Molecular weight:
Calculated MW: 40kDa Observed MW: 40kDa
Form:
Liquid
Applications:
Request info at info@sobekbio.com
Dilution:
WB 1:1000 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
