KLRK1 Rabbit pAb (APR18691N) APR18691N
Specifications
| 50µl / 100µl / 200µl |
Product info:
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells. This gene encodes a member of the NKG2 family. The encoded transmembrane protein is characterized by a type II membrane orientation (has an extracellular C terminus) and the presence of a C-type lectin domain. It binds to a diverse family of ligands that include MHC class I chain-related A and B proteins and UL-16 binding proteins, where ligand-receptor interactions can result in the activation of NK and T cells. The surface expression of these ligands is important for the recognition of stressed cells by the immune system, and thus this protein and its ligands are therapeutic targets for the treatment of immune diseases and cancers. Read-through transcription exists between this gene and the upstream KLRC4 (killer cell lectin-like receptor subfamily C, member 4) family member in the same cluster.
Alternative names:
KLRK1; CD314; D12S2489E; KLR; NKG2-D; NKG2D
Species reactivity:
Human
Host:
Rabbit
Cellular localisation:
Cell membrane, Single-pass type II membrane protein
Isotype:
IgG
Immunogen:
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KLRK1 (NP_031386.2).
Positive control:
Request info at info@sobekbio.com
AA Sequence:
ASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVK
Purification:
Affinity purification
Molecular weight:
Calculated MW: 25kDa Observed MW: Refer to figures
Form:
Liquid
Applications:
Request info at info@sobekbio.com
Dilution:
IF 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
