p38 MAPK Rabbit pAb (APR23382N) APR23382N
Specifications
| 50µl / 100µl / 200µl |
Product info:
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Alternative names:
MAPK14; CSBP; CSBP1; CSBP2; CSPB1; EXIP; Mxi2; PRKM14; PRKM15; RK; SAPK2A; p38; p38ALPHA; p38 MAPK
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Cytoplasm, Nucleus
Isotype:
IgG
Immunogen:
A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human p38 MAPK (NP_620581.1).
Positive control:
U-87MG, BxPC-3, LO2, mouse brain, mouse kidney, mouse liver, mouse pancreas, mouse testis, rat kidney
AA Sequence:
AQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Purification:
Affinity purification
Molecular weight:
Calculated MW: 29kDa/34kDa/35kDa/41kDa Observed MW: 41kDa
Form:
Liquid
Applications:
Request info at info@sobekbio.com
Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
