Histone H3 Rabbit pAb (APR24762N) APR24762N
Specifications
| 50µl / 100µl / 200µl |
Product info:
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.
Alternative names:
H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A
Species reactivity:
Human, Mouse, Rat, Other (Wide Range)
Host:
Rabbit
Cellular localisation:
Chromosome, Nucleus
Isotype:
IgG
Immunogen:
A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human HIST3H3 (NP_003484.1).
Positive control:
HeLa, HepG2, NIH/3T3, Raji, C6, Rat lung
AA Sequence:
REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
Purification:
Affinity purification
Molecular weight:
Calculated MW: 15kDa Observed MW: 17KDa
Form:
Liquid
Applications:
WB (Mouse embryonic fibroblasts, Raw264.7, Rat brain, HNSCs, Arabidopsis thaliana, Homo sapiens, Mus musculus, Plasmodium falciparum, Rattus norvegicus, Oryza sativa, Gallus gallus, Danio rerio, Bombyx mori Linnaeus, Saccharomyces cerevisiae) IF (Mouse E16.5 neocortex, Homo sapiens)
Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200 ChIP 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
