Rabbit anti GST-Tag pAb (APR28862N) APR28862N
Specifications
| 100µl / 200µl |
Product info:
Glutathione S-transferases (GSTs), previously known as ligandins, comprise a family of eukaryotic and prokaryotic phase II metabolic isozymes best known for their ability to catalyze the conjugation of the reduced form of glutathione (GSH) to xenobiotic substrates for the purpose of detoxification. The GST family consists of three superfamilies: the cytosolic, mitochondrial, and microsomal—also known as MAPEG—proteins. Members of the GST superfamily are extremely diverse in amino acid sequence, and a large fraction of the sequences deposited in public databases are of unknown function. The Enzyme Function Initiative (EFI) is using GSTs as a model superfamily to identify new GST functions.A GST-tag is often used to separate and purify proteins that contain the GST-fusion protein. The tag is 220 amino acids (roughly 26 KDa) in size, which, compared to tags such as the Myc-tag or the FLAG-tag, is quite large. It can be fused to either the N-terminus or C-terminus of a protein. However, many commercially available sources of GST-tagged plasmids include a thrombin domain for cleavage of the GST tag during protein purification.
Alternative names:
GST; GST tag; GST-tag
Species reactivity:
Request info at info@sobekbio.com
Host:
Rabbit
Cellular localisation:
Request info at info@sobekbio.com
Isotype:
IgG
Immunogen:
Recombinant protein containing a sequence corresponding to amino acids 1-218 of GST protein.
Positive control:
GST fusion protein
AA Sequence:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Purification:
Affinity purification
Molecular weight:
Calculated MW: 26kDa Observed MW: Refer to Figures
Form:
Liquid
Applications:
WB (Mus musculus, Homo sapiens, Rattus norvegicus, Dendroaspis polylepis) IP (Mus musculus, Homo sapiens) IF (Mus musculus) Co-IP (Homo sapiens, Mus musculus)
Dilution:
WB 1:1000 - 1:2000 IF 1:20 - 1:50 IP 1:20 - 1:50
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
