Skip to main content

Leading Biology

LeadingBiology

With experienced biologists, Leading Biology continuously optimizes the process and the quality assurance in manufacturing, dedicated to exploring and designing products on a higher level. The specialty in antibody engineering and synthetic biology make it possible to develop effective, convenient and simplified products with excellent performance in research. In national and international collaborations, their team of biologists has applied their experience and research results to the development of biological products to meet our customers’ different needs.

Leading Biology offers more than 30,000 self-developed antibodies & proteins, hundreds of ELISA kits, and proteins.

www.leadingbiology.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

[KO Validated] Calreticulin Rabbit pAb (APR29618N) APR29618N



The add to cart button will appear once you select the values above

Specifications

50µl / 100µl / 200µl

Product info:

Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro/SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium. The amino terminus of calreticulin interacts with the DNA-binding domain of the glucocorticoid receptor and prevents the receptor from binding to its specific glucocorticoid response element. Calreticulin can inhibit the binding of androgen receptor to its hormone-responsive DNA element and can inhibit androgen receptor and retinoic acid receptor transcriptional activities in vivo, as well as retinoic acid-induced neuronal differentiation. Thus, calreticulin can act as an important modulator of the regulation of gene transcription by nuclear hormone receptors.

Alternative names:

CALR; CRT; HEL-S-99n; RO; SSA; cC1qR

Species reactivity:

Human, Mouse, Rat

Host:

Rabbit

Cellular localisation:

Cell surface, Cytoplasm, Endoplasmic reticulum lumen, Sarcoplasmic reticulum lumen, Secreted, cytosol, extracellular matrix, extracellular space

Isotype:

IgG

Immunogen:

Recombinant fusion protein containing a sequence corresponding to amino acids 18-417 of human Calreticulineticulin (NP_004334.1).

Positive control:

NIH/3T3, SH-SY5Y, Mouse liver, Rat liver, Rat testis

AA Sequence:

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Purification:

Affinity purification

Molecular weight:

Calculated MW: 48kDa Observed MW: 55KDa

Form:

Liquid

Applications:

Request info at info@sobekbio.com

Dilution:

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100 IP 1:50 - 1:200

Storage buffer:

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Storage:

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

More info:

Email: info@sobekbio.com

Orders:

Email: orders@sobekbio.com