[KO Validated] ERK2 Rabbit pAb (APR18368N) APR18368N
Specifications
| 50µl / 100µl / 200µl |
Product info:
This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.
Alternative names:
ERK; ERK-2; ERK2; ERT1; MAPK2; P42MAPK; PRKM1; PRKM2; p38; p40; p41; p41mapk; p42-MAPK; MAPK1
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center, spindle
Isotype:
IgG
Immunogen:
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK2 (NP_620407.1).
Positive control:
HeLa, A-549, NIH/3T3, C6, Mouse brain, Mouse thymus, Rat brain
AA Sequence:
LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
Purification:
Affinity purification
Molecular weight:
Calculated MW: 36kDa/41kDa Observed MW: 42KDa
Form:
Liquid
Applications:
IHC (Mouse embryonal fibroblast cell) WB (Mouse embryonal fibroblast cell, H460, Mus musculus, Rattus norvegicus)
Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
