[KO Validated] CDKN2A/p16INK4a Rabbit pAb (APR17377N) APR17377N
Specifications
| 50µl / 100µl / 200µl |
Product info:
This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, the E3 ubiquitin-protein ligase MDM2, a protein responsible for the degradation of p53. In spite of the structural and functional differences, the CDK inhibitor isoforms and the ARF product encoded by this gene, through the regulatory roles of CDK4 and p53 in cell cycle G1 progression, share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors, and is known to be an important tumor suppressor gene.
Alternative names:
CDKN2A; ARF; CDK4I; CDKN2; CMM2; INK4; INK4A; MLM; MTS-1; MTS1; P14; P14ARF; P16; P16-INK4A; P16INK4; P16INK4A; P19; P19ARF; TP16
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Cytoplasm, Nucleus
Isotype:
IgG
Immunogen:
A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human CDKN2A/p16INK4a
Positive control:
HeLa, 293T
AA Sequence:
NCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Purification:
Affinity purification
Molecular weight:
Calculated MW: 8kDa/11kDa/12kDa/13kDa/16kDa/17kDa Observed MW: 17KDa
Form:
Liquid
Applications:
IF (Mus musculus) WB (Mus musculus, Homo sapiens, Rattus norvegicus) IHC (Mus musculus) ICC (Homo sapiens, Mus musculus)
Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
