[KO Validated] B4GALT1 Rabbit pAb (APR28327N) APR28327N
Specifications
| 50µl / 100µl / 200µl |
Product info:
This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. This gene is unique among the beta4GalT genes because it encodes an enzyme that participates both in glycoconjugate and lactose biosynthesis. For the first activity, the enzyme adds galactose to N-acetylglucosamine residues that are either monosaccharides or the nonreducing ends of glycoprotein carbohydrate chains. The second activity is restricted to lactating mammary tissues where the enzyme forms a heterodimer with alpha-lactalbumin to catalyze UDP-galactose + D-glucose <=> UDP + lactose. The two enzymatic forms result from alternate transcription initiation sites and post-translational processing. Two transcripts, which differ only at the 5' end, with approximate lengths of 4.1 kb and 3.9 kb encode the same protein. The longer transcript encodes the type II membrane-bound, trans-Golgi resident protein involved in glycoconjugate biosynthesis. The shorter transcript encodes a protein which is cleaved to form the soluble lactose synthase.
Alternative names:
B4GALT1; B4GAL-T1; CDG2D; GGTB2; GT1; GTB; beta4Gal-T1; beta-1
Species reactivity:
Human, Mouse, Rat
Host:
Rabbit
Cellular localisation:
Cell membrane, Cell projection, Cell surface, Golgi apparatus, Golgi stack membrane, Secreted, Single-pass type II membrane protein, filopodium
Isotype:
IgG
Immunogen:
Recombinant fusion protein containing a sequence corresponding to amino acids 50-215 of human B4GALT1 (NP_001488.2).
Positive control:
LO2, HeLa, 22Rv1
AA Sequence:
LPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVIN
Purification:
Affinity purification
Molecular weight:
Calculated MW: 42kDa/43kDa Observed MW: 55kDa
Form:
Liquid
Applications:
WB (Homo sapiens) IHC (Mus musculus)
Dilution:
WB 1:500 - 1:2000 IHC 1:50 - 1:100
Storage buffer:
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Storage:
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
More info:
Email: info@sobekbio.com
Orders:
Email: orders@sobekbio.com
