Alternative Name(s):

Cardiac myosin light chain-2; Cardiac ventricular myosin light chain 2; CMH10; MLC 2v ; MLC-2; MLC-2v; MLC2; MLRV_HUMAN; MYL 2; MYL2; Myosin light chain 2 regulatory cardiac slow; Myosin light polypeptide 2 regulatory cardiac slow; Myosin regulatory light chain 2; Myosin regulatory light chain 2 ventricular/cardiac muscle isoform; Regulatory light chain of myosin; RLC of myosin; Slow cardiac myosin regulatory light chain 2; ventricular/cardiac muscle isoform

Species: (Organism)

Homo sapiens (Human)

Gene Names:

MYL2

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

KRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEE

Expression Region:

8-164aa

Subcellular Location:

Cytoplasm, myofibril, sarcomere, A band

Tissue Specificity:

Protein Length:

Partial

Pathway:

Cardiacmusclecontraction

Mol. Weight:

21.8 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cardiovascular

Function:

Contractile protein that plays a role in heart development and function (By similarity). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (By similarity).

Involvement in disease:

Cardiomyopathy, familial hypertrophic 10 (CMH10)

Relevance:

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

ErratumRichard P., Charron P., Carrier L., Ledeuil C., Cheav T., Pichereau C., Benaiche A., Isnard R., Dubourg O., Burban M., Gueffet J.-P., Millaire A., Desnos M., Schwartz K., Hainque B., Komajda M.Circulation 109:3258-3258(2004)