Alternative Name(s):

Selenoprotein P-like protein

Species: (Organism)

Bos taurus (Bovine)

Gene Names:

SELENOP

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

ESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASSYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLSRKRCINQLLSQFPKDSESALSSCCCHCRHLVFEKTGSAITSQCTEKLPSLCSSQGLLAEENVIESSQSRLPPAASQAAGQQLNPTEASTKSSSKNKAKMSKSPSN

Expression Region:

20-402aa (U59S,U297S,U307S,U338S,U350S,U363S,U365S,U372S,U388S,U390S,U397S,U399S)

Subcellular Location:

Secreted

Tissue Specificity:

Brain and kidney. Most prominently expressed in the cerebellar cortex, hippocampus and olfactory bulb.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

70.1 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells.

Involvement in disease:

Relevance:

Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Selenoprotein P family

Reference:

Molecular cloning of cDNA encoding a bovine selenoprotein P-like protein containing 12 selenocysteines and a (His-Pro) rich domain insertion, and its regional expression.Saijoh K., Saito N., Lee M.J., Fujii M., Kobayashi T., Sumino K.Brain Res. Mol. Brain Res. 30:301-311(1995)