Alternative Name(s):

(CP-H)(Protein II)

Species: (Organism)

Human adenovirus F serotype 40 (HAdV-40) (Human adenovirus 40)

Gene Names:

L3

Tag info:

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

MATPSMMPQWSYMHIAGQDASEYLSPGLVQFARATDTYFSLGNKFRNPTVAPTHDVTTDRSQRLTLRFVPVDREETAYSYKVRFTLAVGDNRVLDMASTYFDIRGVLDRGPSFKPYSGTAYNSLAPKGAPNPSQWTNQNKTNSFGQAPYIGQKITNQGVQVGSDSNNRDVFADKTYQPEPQVGQTQWNINPMQNAAGRILKQTTPMQPCYGSYARPTNEKGGQAKLVKNDDNQTTTTN

Expression Region:

1-238aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

40.8 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Involvement in disease:

Relevance:

Major capsid protein that self-associates to form 240 hexon trimers, each in the shape of a hexagon, building most of the pseudo T=25 capsid. Assembled into trimeric units with the help of the chaperone shutoff protein. Transported by pre-protein VI to the nucleus where it associates with other structural proteins to form an empty capsid. Might be involved, through its interaction with host dyneins, in the intracellular microtubule-dependent transport of incoming viral capsid to the nucleus.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"The genes encoding the DNA binding protein and the 23K protease of adenovirus types 40 and 41." Vos H.L., der Lee F.M., Reemst A.M.C.B., van Loon A.E., Sussenbach J.S. Virology 163:1-10(1988).