Alternative Name(s):

(Interferon-stimulated gene 12 protein)(ISG12)

Species: (Organism)

Mus musculus (Mouse)

Gene Names:

Ifi27l2a

Tag info:

N-terminal 10xHis-tagged

Target Protein AA Sequence:

AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGAAVGALL

Expression Region:

25-90aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

7.3 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Involvement in disease:

Relevance:

May be involved in the interferon-induced negative regulation of the transcriptional activity of NR4A1, NR4A2 and NR4A3 through the enhancement of XPO1-mediated nuclear export of these nuclear receptors . Through the regulation of NR4A1 transcriptional activity, may play a role in the vascular response to injury .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors." Papac-Milicevic N., Breuss J.M., Zaujec J., Ryban L., Plyushch T., Wagner G.A., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass C.K., Binder C.J., Uhrin P., Binder B.R. Circ. Res. 110:E50-E63(2012)