Alternative Name(s):

(Chemerin chemokine-like receptor 2)(Chemokine-like receptor 2)(G-protein coupled receptor 1)

Species: (Organism)

Rattus norvegicus (Rat)

Gene Names:

Cmklr2

Tag info:

N-terminal 10xHis-tagged

Target Protein AA Sequence:

MEVSREMLFEELDNYSYALEYYSQEPDAEENVYPGIVHWISLLLYALAFVLGIPGNAIVIWFMGFKWKKTVTTLWFLNLAIADFVFVLFLPLYISYVALSFHWPFGRWLCKLNSFIAQLNMFSSVFFLTVISLDRYIHLIHPGLSHPHRTLKNSLLVVLFVWLLASLLGGPTLYFRDTVEVNNRIICYNNFQEYELTLMRHHVLTWVKFLFGYLLPLLTMSSCYLCLIFKTKKQNILISSKHLWMILSVVIAFMVCWTPFHLFSIWELSIHHNSSFQNVLQGGIPLSTGLAFLNSCLNPILYVLISKKFQARFRASVAEVLKRSLWEASCSGTVSEQLRSAETKSLSLLETAQ

Expression Region:

1-353aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

42.4 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

Involvement in disease:

Relevance:

Receptor for chemoattractant adipokine chemerin/RARRES2 suggesting a role for this receptor in the regulation of inflammation and energy homesotasis . Signals mainly via beta-arrestin pathway. Binding of RARRES2 activates weakly G proteins, calcium mobilization and MAPK1/MAPK3 (ERK1/2) phosphorylation too. Acts also as a receptor for TAFA1, mediates its effects on neuronal stem-cell proliferation and differentiation via the activation of ROCK/ERK and ROCK/STAT3 signaling pathway .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"Mapping studies of two G protein-coupled receptor genes: an amino acid difference may confer a functional variation between a human and rodent receptor." Marchese A., Cheng R., Lee M.C., Porter C.A., Heiber M., Goodman M., George S.R., O'Dowd B.F. Biochem. Biophys. Res. Commun. 205:1952-1958(1994)