Alternative Name(s):

(LRP-2)(Glycoprotein 330)(gp330)(Megalin)

Species: (Organism)

Homo sapiens (Human)

Gene Names:

LRP2

Tag info:

C-terminal mFc-tagged

Target Protein AA Sequence:

NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE

Expression Region:

1186-1389aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

50.8 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Immunology

Function:

Involvement in disease:

Relevance:

Multiligand endocytic receptor . Acts together with CUBN to mediate endocytosis of high-density lipoproteins . Mediates receptor-mediated uptake of polybasic drugs such as aprotinin, aminoglycosides and polymyxin B . In the kidney, mediates the tubular uptake and clearance of leptin . Also mediates transport of leptin across the blood-brain barrier through endocytosis at the choroid plexus epithelium . Endocytosis of leptin in neuronal cells is required for hypothalamic leptin signaling and leptin-mediated regulation of feeding and body weight . Mediates endocytosis and subsequent lysosomal degradation of CST3 in kidney proximal tubule cells . Mediates renal uptake of 25-hydroxyvitamin D3 in complex with the vitamin D3 transporter GC/DBP . Mediates renal uptake of metallothionein-bound heavy metals . Together with CUBN, mediates renal reabsorption of myoglobin . Mediates renal uptake and subsequent lysosomal degradation of APOM . Plays a role in kidney selenium homeostasis by mediating renal endocytosis of selenoprotein SEPP1 . Mediates renal uptake of the antiapoptotic protein BIRC5/survivin which may be important for functional integrity of the kidney . Mediates renal uptake of matrix metalloproteinase MMP2 in complex with metalloproteinase inhibitor TIMP1 . Mediates endocytosis of Sonic hedgehog protein N-product (ShhN), the active product of SHH . Also mediates ShhN transcytosis . In the embryonic neuroepithelium, mediates endocytic uptake and degradation of BMP4, is required for correct SHH localization in the ventral neural tube and plays a role in patterning of the ventral telencephalon . Required at the onset of neurulation to sequester SHH on the apical surface of neuroepithelial cells of the rostral diencephalon ventral midline and to control PTCH1-dependent uptake and intracellular trafficking of SHH . During neurulation, required in neuroepithelial cells for uptake of folate bound to the folate receptor FOLR1 which is necessary for neural tube closure . In the adult brain, negatively regulates BMP signaling in the subependymal zone which enables neurogenesis to proceed . In astrocytes, mediates endocytosis of ALB which is required for the synthesis of the neurotrophic factor oleic acid . Involved in neurite branching . During optic nerve development, required for SHH-mediated migration and proliferation of oligodendrocyte precursor cells . Mediates endocytic uptake and clearance of SHH in the retinal margin which protects retinal progenitor cells from mitogenic stimuli and keeps them quiescent . Plays a role in reproductive organ development by mediating uptake in reproductive tissues of androgen and estrogen bound to the sex hormone binding protein SHBG . Mediates endocytosis of angiotensin-2 . Also mediates endocytosis of angiotensis 1-7 . Binds to the complex composed of beta-amyloid protein 40 and CLU/APOJ and mediates its endocytosis and lysosomal degradation . Required for embryonic heart development . Required for normal hearing, possibly through interaction with estrogen in the inner ear .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

A protein involved in calcium sensing of the human parathyroid and placental cytotrophoblast cells belongs to the LDL-receptor protein superfamily.Lundgren S., Hjaelm G., Hellman P., Ek B., Juhlin C., Rastad J., Klareskog L., Aakerstroem G., Rask L.Exp. Cell Res. 212:344-350(1994)