Alternative Name(s):

(CGX-1002)

Species: (Organism)

Conus marmoreus (Marble cone)

Gene Names:

N/A

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

ACSKKWEYCIVPILGFVYCCPGLICGPFVCV

Expression Region:

52-82aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

30.3 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Involvement in disease:

Relevance:

MuO-conotoxins are gating-modifier toxins that inhibit sodium current by trapping the domain II voltage sensor in the closed position to prevent opening of the sodium channel. This toxin has a preference for Nav1.4/SCN4A over Nav1.2/SCN2A sodium channels. It blocks Nav channels by interacting mainly with the C-terminal part of the pore loop of domain-3. It also blocks fast-inactivating calcium current. Blocks Nav1.8/SCN10A sodium channels and has potent and long-lasting local anesthetic effects. It can also block propagation of action potentials in A- and C-fibers in sciatic nerve as well as skeletal muscle in isolated preparations.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"Synthetic muO-conotoxin MrVIB blocks TTX-resistant sodium channel NaV1.8 and has a long-lasting analgesic activity." Bulaj G., Zhang M.M., Green B.R., Fiedler B., Layer R.T., Wei S., Nielsen J.S., Low S.J., Klein B.D., Wagstaff J.D., Chicoine L., Harty T.P., Terlau H., Yoshikami D., Olivera B.M. Biochemistry 45:7404-7414(2006)