Alternative Name(s):

(DHH)(HHG-3)

Species: (Organism)

Homo sapiens (Human)

Gene Names:

DHH

Tag info:

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

GVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNK

Expression Region:

51-158AA

Subcellular Location:

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

42.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Involvement in disease:

Relevance:

[Desert hedgehog protein]: The C-terminal part of the desert hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity . Both activities result in the cleavage of the full-length protein into two parts (N-product and C-product) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product . Both activities occur in the reticulum endoplasmic . Functions in cell-cell mediated juxtacrine signaling . Promotes endothelium integrity . Binds to PTCH1 receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes in endothelial cells . In Schwann cells, controls the development of the peripheral nerve sheath and the transition of mesenchymal cells to form the epithelium-like structure of the perineurial tube . [Desert hedgehog protein N-product]: The dually lipidated desert hedgehog protein N-product is essential for a variety of patterning events during development . Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes . Required for normal testis development and spermatogenesis, namely for the formation of adult-type Leydig cells and normal development of peritubular cells and seminiferous tubules . Activates primary cilia signaling on neighboring valve interstitial cells through a paracrine mechanism . May induce motor neurons in lateral neural tube and may have a polarizing activity . Prevents the desert hedgehog protein precursor binding to PTCH1 .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"Full-length Dhh and N-terminal Shh act as competitive antagonists to regulate angiogenesis and vascular permeability." Hollier P.L., Chapouly C., Diop A., Guimbal S., Cornuault L., Gadeau A.P., Renault M.A. Cardiovasc. Res. 117:2489-2501(2021)