Recombinant Bovine Cation-independent mannose-6-phosphate receptor(IGF2R),partial CSB-MP011093BO
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
(CI Man-6-P receptor)(CI-MPR)(M6PR)(300 kDa mannose 6-phosphate receptor)(MPR 300)(Insulin-like growth factor 2 receptor)(Insulin-like growth factor II receptor)(IGF-II receptor)(CD antigen CD222)
Species: (Organism)
Bos taurus (Bovine)
Gene Names:
IGF2R
Tag info:
C-terminal hFc-tagged
Target Protein AA Sequence:
LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Expression Region:
628-772aa
Subcellular Location:
Tissue Specificity:
Protein Length:
Partial
Pathway:
Mol. Weight:
46.1 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Immunology
Function:
Involvement in disease:
Relevance:
Mediates the transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelysosomal compartment where the low pH mediates the dissociation of the complex. The receptor is then recycled back to the Golgi for another round of trafficking through its binding to the retromer. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation by binding DPP4.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
"Specificity of binding of clathrin adapters to signals on the mannose-6-phosphate/insulin-like growth factor II receptor." Glickman J.N., Conibear E., Pearse B.M.F. EMBO J. 8:1041-1047(1989)
