Alternative Name(s):

(ST)(ST-AG)

Species: (Organism)

JC polyomavirus (JCPyV) (JCV)

Gene Names:

N/A

Tag info:

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

MDKVLNREESMELMDLLGLDRSAWGNIPVMRKAYLKKCKELHPDKGGDEDKMKRMNFLYKKMEQGVKVAHQPDFGTWNSSEVGCDFPPNSDTLYCKEWPNCATNPSVHCPCLMCMLKLRHRNRKFLRSSPLVWIDCYCFDCFRQWFGCDLTQEALHCWEKVLGDTPYRDLKL

Expression Region:

1-172aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

27.7 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Involvement in disease:

Relevance:

Promotes efficient viral genome replication by modulating several host signaling pathways including transport network, interferon production or cell cycle progression. Inhibits host PP2A phosphatase activity and thereby prevents agnoprotein dephosphorylation. Inactivation of PP2A also results in the transactivation of cyclin A and cyclin D1 promoters. In addition, antagonizes the RIG-I/DDX58-mediated IFN response through interaction with E3 ligase TRIM25 leading to the inhibition of 'Lys-63'-linked ubiquitination of DDX58. Inhibits nucleotide excision repair (NER) pathway which leads to DNA strand breaks during DNA replication and micronuclei formation.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"The Small t Antigen of JC Virus Antagonizes RIG-I-Mediated Innate Immunity by Inhibiting TRIM25's RNA Binding Ability." Chiang C., Dvorkin S., Chiang J.J., Potter R.B., Gack M.U. MBio 12:0-0(2021)