Alternative Name(s):

(Omega-CNTX-Pn3a)(Neurotoxin Tx3-4)(Omega-phonetoxin-2A)(Omega-phonetoxin-IIA)(Omega-Ptx-IIA)(PF3)(Phoneutriatoxin 3-4)(Pn3-4A)

Species: (Organism)

Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)

Gene Names:

N/A

Tag info:

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

SCINVGDFCDGKKDDCQCCRDNAFCSCSVIFGYKTNCRCEVGTTATSYGICMAKHKCGRQTTCTKPCLSKRCKKNH

Expression Region:

40-115aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

15.8 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Involvement in disease:

Relevance:

This toxin is a potent and practically irreversible antagonist of both Cav2.1/CACNA1A and Cav2.2/CACNA1B calcium channels, while it displays a partial and rapidly reversible block of Cav2.3/CACNA1E calcium channels and no effect on Cav3/CACNA1 calcium channels. Inhibits glutamate uptake from rat brain synaptosomes by an interaction between cysteines from both glutamate transporter and toxin. Blocks potassium-induced exocytosis of synaptic vesicles in brain cortical synaptosomes with an IC(50) of 1.1 nM. In mice, induces rapid general flaccid paralysis followed by death in 10-30 minutes at dose levels of 5 ug per mouse. In rat brain, inhibits glutamate release, neuronal death and loss of neurotransmission in the hippocampus resulting from ischemia.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"Phoneutria spider toxins block ischemia-induced glutamate release, neuronal death, and loss of neurotransmission in hippocampus." Pinheiro A.C., da Silva A.J., Prado M.A., Cordeiro M.D., Richardson M., Batista M.C., de Castro Junior C.J., Massensini A.R., Guatimosim C., Romano-Silva M.A., Kushmerick C., Gomez M.V. Hippocampus 19:1123-1129(2009)