Alternative Name(s):

(NADase SARM1)(hSARM1)(NADP(+) hydrolase SARM1)(Sterile alpha and Armadillo repeat protein)(Sterile alpha and TIR motif-containing protein 1)(Sterile alpha motif domain-containing protein 2)(MyD88-5)(SAM domain-containing protein 2)(Tir-1 homolog)(HsTIR)

Species: (Organism)

Homo sapiens (Human)

Gene Names:

SARM1

Tag info:

N-terminal 6xHis-KSI-tagged

Target Protein AA Sequence:

VPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGR

Expression Region:

409-702aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

48.8 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

Involvement in disease:

Relevance:

NAD(+) hydrolase, which plays a key role in axonal degeneration following injury by regulating NAD(+) metabolism . Acts as a negative regulator of MYD88- and TRIF-dependent toll-like receptor signaling pathway by promoting Wallerian degeneration, an injury-induced form of programmed subcellular death which involves degeneration of an axon distal to the injury site . Wallerian degeneration is triggered by NAD(+) depletion: in response to injury, SARM1 is activated and catalyzes cleavage of NAD(+) into ADP-D-ribose (ADPR), cyclic ADPR (cADPR) and nicotinamide; NAD(+) cleavage promoting cytoskeletal degradation and axon destruction . Also able to hydrolyze NADP(+), but not other NAD(+)-related molecules . Can activate neuronal cell death in response to stress . Regulates dendritic arborization through the MAPK4-JNK pathway. Involved in innate immune response: inhibits both TICAM1/TRIF- and MYD88-dependent activation of JUN/AP-1, TRIF-dependent activation of NF-kappa-B and IRF3, and the phosphorylation of MAPK14/p38 .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"SARM inhibits both TRIF- and MyD88-mediated AP-1 activation." Peng J., Yuan Q., Lin B., Panneerselvam P., Wang X., Luan X.L., Lim S.K., Leung B.P., Ho B., Ding J.L. Eur. J. Immunol. 40:1738-1747(2010)