Alternative Name(s):

Progonadoliberin-1(Progonadoliberin I) [Cleaved into: Gonadoliberin-1(Gonadoliberin I)(Gonadotropin-releasing hormone I)(GnRH-I)(Luliberin I)(Luteinizing hormone-releasing hormone I)(LH-RH I); Prolactin release-inhibiting factor 1(Prolactin release-inhibiting factor I)]

Species: (Organism)

Rattus norvegicus (Rat)

Gene Names:

Gnrh1

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

QHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM

Expression Region:

24-92aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

12.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Developmental Biology

Function:

Involvement in disease:

Relevance:

Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"Adhesion-related kinase repression of gonadotropin-releasing hormone gene expression requires Rac activation of the extracellular signal-regulated kinase pathway." Allen M.P., Xu M., Linseman D.A., Pawlowski J.E., Bokoch G.M., Heidenreich K.A., Wierman M.E. J Biol Chem 277:38133-38140(2002)