Alternative Name(s):

CysLTR1;Cysteinyl leukotriene D4 receptor;LTD4 receptor;G-protein coupled receptor HG55;HMTMF81

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CYSLTR1

Tag info:

N-terminal 10xHis-tagged

Target Protein AA Sequence:

MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV

Expression Region:

1-337aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

44.6 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

others

Function:

Involvement in disease:

Relevance:

Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"Identification, molecular cloning, expression, and characterization of a cysteinyl leukotriene receptor." Sarau H.M., Ames R.S., Chambers J., Ellis C., Elshourbagy N., Foley J.J., Schmidt D.B., Muccitelli R.M., Jenkins O., Murdock P.R., Herrity N.C., Halsey W., Sathe G., Muir A.I., Nuthulaganti P., Dytko G.M., Buckley P.T., Wilson S., Bergsma D.J., Hay D.W.P. Mol. Pharmacol. 56:657-663(1999)