Alternative Name(s):

Cancer/testis antigen 2.2

Species: (Organism)

Homo sapiens (Human)

Gene Names:

BAGE2

Tag info:

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

RLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEPTAFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS

Expression Region:

18-109aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

17.9 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cancer

Function:

Involvement in disease:

Relevance:

Unknown. Candidate gene encoding tumor antigens. Miscellaneous The ancestral BAGE gene was generated by juxtacentromeric reshuffling of the KMT2C/MLL3 gene. The BAGE family was expanded by juxtacentromeric movement and/or acrocentric exchanges. BAGE family is composed of expressed genes that map to the juxtacentromeric regions of chromosomes 13 and 21 and of unexpressed gene fragments that scattered in the juxtacentromeric regions of several chromosomes, including chromosomes 9, 13, 18 and 21.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"New BAGE (B melanoma antigen) genes mapping to the juxtacentromeric regions of human chromosomes 13 and 21 have a cancer/testis expression profile." Ruault M., van der Bruggen P., Brun M.-E., Boyle S., Roizes G., De Sario A. Eur. J. Hum. Genet. 10:833-840(2002)