Alternative Name(s):

Alpha-anatoxin Amm VIII

Species: (Organism)

Androctonus mauritanicus mauritanicus (Scorpion)

Gene Names:

N/A

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

LKDGYIVNDINCTYFCGRNAYCNELCIKLKGESGYCQWASPYGNSCYCYKLPDHVRTKGPGRCND

Expression Region:

20-84aa

Subcellular Location:

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

9.4 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Involvement in disease:

Relevance:

Alpha toxins bind voltage-independently at site-3 of sodium channels and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission . The toxin principally slows the inactivation process of TTX-sensitive sodium channels . It discriminates neuronal versus muscular sodium channel, as it is more potent on rat brain Nav1.2/SCN2A than on rat skeletal muscle Nav1.4/SCN4A . It also shows a weak activity on Nav1.7/SCN9A . In vivo, the toxin produces pain hypersensibility to mechanical and thermal stimuli.. It also exhibits potent analgesic activity , increasing hot plate and tail flick withdrawal latencies in a dose-dependent fashion . This paradoxical analgesic action, is significantly suppressed by opioid receptor antagonists, suggesting a pain-induced analgesia mechanism that involves an endogenous opioid system . This led to hypothesis that pain relief induced by peripheral administration of Amm VIII may result from sensitization of primary afferent neurons and subsequent activation of an opioid-dependent noxious inhibitory control .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"New analysis of the toxic compounds from the Androctonus mauretanicus mauretanicus scorpion venom." Oukkache N., Rosso J.-P., Alami M., Ghalim N., Saile R., Hassar M., Bougis P.E., Martin-Eauclaire M.-F. Toxicon 51:835-852(2008)