Alternative Name(s):

T-cell receptor T3 gamma chain CD_antigen: CD3g

Species: (Organism)

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Gene Names:

CD3G

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

Expression Region:

23-113aa

Subcellular Location:

Cell membrane, Single-pass type I membrane protein

Tissue Specificity:

Protein Length:

Extracellular Domain

Pathway:

Mol. Weight:

12.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Immunology

Function:

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G.

Involvement in disease:

Relevance:

The CD3 complex mediates signal transduction.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"CD3 polymorphism in cynomolgus monkeys (Macaca fascicularis)."Uda A., Tanabayashi K., Mukai R., Yachi M., Nam K., Yamada A.J. Med. Primatol. 30:141-147(2001) .