Recombinant Human Dedicator of cytokinesis protein 8(DOCK8),partial CSB-YP836734HUb0
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
DOCK8Dedicator of cytokinesis protein 8
Species: (Organism)
Homo sapiens (Human)
Gene Names:
DOCK8
Tag info:
N-terminal 10xHis-tagged
Target Protein AA Sequence:
RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV
Expression Region:
560-729aa
Subcellular Location:
Cytoplasm, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, lamellipodium membrane, Peripheral membrane protein, Cytoplasmic side
Tissue Specificity:
Expressed in peripheral blood mononuclear cells (PBMCs).
Protein Length:
Partial
Pathway:
Mol. Weight:
21.8 kDa
Purity:
Greater than 85% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Guanine nucleotide exchange factor (GEF) which specifically activates small GTPase CDC42 by exchanging bound GDP for free GTP
Involvement in disease:
Hyperimmunoglobulin E recurrent infection syndrome, autosomal recessive (AR-HIES); Mental retardation, autosomal dominant 2 (MRD2)
Relevance:
Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP. Is involved in NK cell cytotoxicity by controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
DOCK family
Reference:
"The region on 9p associated with 46,XY sex reversal contains several transcripts expressed in the urogenital system and a novel doublesex-related domain." Ottolenghi C., Veitia R., Quintana-Murci L., Torchard D., Scapoli L., Souleyreau-Therville N., Beckmann J., Fellous M., McElreavey K. Genomics 64:170-178(2000)
