Alternative Name(s):

Endothelial cell-specific protein S-1 Epidermal growth factor-like protein 9 Short name: EGF-like protein 9

Species: (Organism)

Mus musculus (Mouse)

Gene Names:

Dlk2

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESS

Expression Region:

27-305aa

Subcellular Location:

Membrane, Single-pass type I membrane protein

Tissue Specificity:

Detected in a number of tissues including lung, brain, adrenal gland, testis, adult liver, placenta, ovary and thymus. Not detected in fetal liver or in adult spleen, muscle and heart.

Protein Length:

Extracellular Domain

Pathway:

Mol. Weight:

31.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Regulates adipogenesis.

Involvement in disease:

Relevance:

Regulates adipogenesis.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"The novel gene EGFL9/Dlk2, highly homologous to Dlk1, functions as a modulator of adipogenesis."Nueda M.L., Baladron V., Garcia-Ramirez J.J., Sanchez-Solana B., Ruvira M.D., Rivero S., Ballesteros M.A., Monsalve E.M., Diaz-Guerra M.J., Ruiz-Hidalgo M.J., Laborda J.J. Mol. Biol. 367:1270-1280(2007)