Alternative Name(s):

CD_antigen: CD124

Species: (Organism)

Sus scrofa (Pig)

Gene Names:

IL4R

Tag info:

N-terminal 6xHis-sumostar-tagged

Target Protein AA Sequence:

VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR

Expression Region:

33-240aa

Subcellular Location:

Membrane, Single-pass type I membrane protein

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

40.2 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cancer

Function:

Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2 (By similarity).

Involvement in disease:

Relevance:

Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Type I cytokine receptor family, Type 4 subfamily

Reference:

"Molecular cloning of the swine IL-4 receptor alpha and IL-13 receptor alpha 1 chains: effects of experimental Toxoplasma gondii and Ascaris suum infections on tissue mRNA levels." Zarlenga D.S. Jr., Dawson H., Solano-Aguilar G., Urban J.F. Jr. Submitted (MAR-2003)