Recombinant Mouse Angiogenin-4(Ang4) CSB-YP661010MO
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
Ang4Angiogenin-4; EC 3.1.27.-
Species: (Organism)
Mus musculus (Mouse)
Gene Names:
Ang4
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
Expression Region:
25-144aa
Subcellular Location:
Cytoplasmic vesicle, secretory vesicle lumen, Secreted, Nucleus, nucleolus
Tissue Specificity:
Detected in small intestine, caecum and colon, with the highest expression in Paneth cells in the intestinal epithelium.
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
29.9 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Cardiovascular
Function:
Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro).
Involvement in disease:
Relevance:
Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Pancreatic ribonuclease family
Reference:
"Angiogenins: a new class of microbicidal proteins involved in innate immunity."Hooper L.V., Stappenbeck T.S., Hong C.V., Gordon J.I.Nat. Immunol. 4:269-273(2003)
