Alternative Name(s):

CD163

Species: (Organism)

Mus musculus (Mouse)

Gene Names:

Cd163

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

VVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCS

Expression Region:

86-365aa

Subcellular Location:

Soluble CD163: Secreted, SUBCELLULAR LOCATION: Cell membrane, Single-pass type I membrane protein

Tissue Specificity:

Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen and mesenteric lymph nodes.

Protein Length:

Partial

Pathway:

Mol. Weight:

32.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1 (By similarity).

Involvement in disease:

Relevance:

Involved in clearance and endocytosis of hoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hoglobin/haptoglobin and subsequent breakdown of he. Binds hoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1 .After shedding, the soluble form (sCD163) may play an anti-inflammatory role.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

Molecular cloning and characterization of the mouse CD163 homologue, a highly glucocorticoid-inducible member of the scavenger receptor cysteine-rich family.Schaer D.J., Boretti F.S., Hongegger A., Poehler D., Linnscheid P., Staege H., Mueller C., Schoedon G., Schaffner A.Immunogenetics 53:170-177(2001)