Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) CSB-YP356390VBG
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
M; Matrix protein
Species: (Organism)
Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV)
Gene Names:
M
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF
Expression Region:
1-237aa
Subcellular Location:
Virion membrane, Peripheral membrane protein, Host endomembrane system, Peripheral membrane protein, Host nucleus membrane, Peripheral membrane protein
Tissue Specificity:
Protein Length:
Full Length
Pathway:
Mol. Weight:
28.8 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Signal Transduction
Function:
Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shut off presumably inhibit interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell (By similarity).
Involvement in disease:
Relevance:
Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shut off presumably inhibit interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Vesiculoviruses matrix protein family
Reference:
"Sequence alterations in temperature-sensitive M-protein mutants (complementation group III) of vesicular stomatitis virus." Gopalakrishna Y., Lenard J. J. Virol. 56:655-659(1985)
