Alternative Name(s):

Css IV

Species: (Organism)

Centruroides suffusus suffusus (Mexican scorpion)

Gene Names:

N/A

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN

Expression Region:

20-85aa

Subcellular Location:

Secreted

Tissue Specificity:

Expressed by the venom gland.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

9.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Involvement in disease:

Relevance:

Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily

Reference:

"Purification and chemical and biological characterizations of seven toxins from the Mexican scorpion, Centruroides suffusus suffusu.Martin M.-F., Garcia Y., Perez L.G., el Ayeb M., Kopeyan C., Bechis G., Jover E., Rochat H.J. Biol. Chem. 262:4452-4459(1987)