Alternative Name(s):

Insecticidal neurotoxin Tx4(6-1) Short name:PNTx4(6-1)

Species: (Organism)

Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)

Gene Names:

PNTx4

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

CGDINAACKEDCDCCGYTTACDCYWSKSCKCREAAIVIYTAPKKKLTC

Expression Region:

35-82aa

Subcellular Location:

Secreted

Tissue Specificity:

Expressed by the venom gland.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

7.3 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

This neurotoxin binds at site 3 of insect voltage-activated sodium channels (Nav) and prolongs evoked axonal action potentials by a slowing down of sodium current inactivation. The toxin inhibits glutamate uptake from rat brain synaptosomes. It is highly toxic to house fly (Musca domestica), toxic to cockroach, but has no effect when intracerebroventricularly injected into mice.

Involvement in disease:

Relevance:

This neurotoxin binds at site 3 of insect voltage-activated sodium channels (Nav) and prolongs evoked axonal action potentials by a slowing down of sodium current inactivation. The toxin inhibits glutamate uptake from rat brain synaptosomes. It is highly toxic to house fly (Musca domestica), toxic to cockroach, but has no effect when intracerebroventricularly injected into mice.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Spider toxin Tx2 family

Reference:

"Molecular cloning of cDNAs encoding insecticidal neurotoxic peptides from the spider Phoneutria nigriventer."Penaforte C.L., Prado V.F., Prado M.A.M., Romano-Silva M.A., Guimaraes P.E.M., De Marco L., Gomez M.V., Kalapothakis E.Toxicon 38:1443-1449(2000)