Recombinant Human Peroxiredoxin-2(PRDX2) CSB-YP339235HU
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
Natural killer cell-enhancing factor B
Species: (Organism)
Homo sapiens (Human)
Gene Names:
PRDX2
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Expression Region:
2-198aa
Subcellular Location:
Cytoplasm
Tissue Specificity:
Protein Length:
Full Length of Mature Protein
Pathway:
Cellageingandmetabolism
Mol. Weight:
23.8 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Neuroscience
Function:
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).
Involvement in disease:
Relevance:
Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Peroxiredoxin family, AhpC/Prx1 subfamily
Reference:
"The thiol-specific antioxidant protein from human brain: gene cloning and analysis of conserved cysteine regions." Lim Y.-S., Cha M.-K., Kim H.-K., Kim I.-H. Gene 140:279-284(1994)
