Alternative Name(s):

HN; Hemagglutinin-neuraminidase; EC 3.2.1.18

Species: (Organism)

Newcastle disease virus (strain Her/33) (NDV)

Gene Names:

HN

Tag info:

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTVTLMGAEGRVLTVGTSHFLYQRGSSYFSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDP

Expression Region:

115-473aa

Subcellular Location:

Virion membrane, Single-pass type II membrane protein, Host cell membrane, Single-pass type II membrane protein

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

42.7 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion (By similarity).

Involvement in disease:

Relevance:

Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion Neuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Paramyxoviruses hemagglutinin-neuraminidase family

Reference:

"Newcastle disease virus evolution. I. Multiple lineages defined by sequence variability of the hemagglutinin-neuraminidase gene." Sakaguchi T., Toyoda T., Gotoh B., Inocencio N.M., Kuma K., Miyata T., Nagai Y. Virology 169:260-272(1989)