Skip to main content

CUSABIO

cusabio

CUSABIO is a National High-Tech Enterprise which combines research, production and sales in one. They are dedicated to providing 60,000+ validated antibodies, 8,000+ recombinant proteins, 660+ cytokines and thousands of ELISA kits to global customers in the research fields of cancer, cell biology, immunology, neuroscience, epigenetics, etc. 

What CUSABIO Does:

As a manufacturer of ELISA kits, Exosome isolation kits, antibodies, proteins and related reagents, their only mission is to provide the best products and related custom service to researchers so that they can have a good start for the next breakthrough. CUSABIO's high quality has been guaranteed by many published literatures in all kinds of famous journals, such as Science, Nature, Cell, Developmental Biology, Molecular Cell, Genes & Development, and so on. Now, the publications citing CUSABIO products has reached more than 4,800, with hundreds of publications updating every year.

Kits

CUSABIO has a sound platform for the development of assay kits, mature antigen-antibody research and development systems. Assay kits offered by CASABIO are mainly two types, including ELISA kits and exosome isolation kits. They are proficient in a variety of ELISA technologies such as the double antibody sandwich method, double antigen sandwich method, direct competition ELISA method, indirect competition ELISA blocking method, indirect ELISA method, and other methods. And fine affinity purification technology for the production of Exosome Isolation Kits is also adopted.

Combined with their diagnostic kits development team, CUSABIO is able to develop ELISA kits with clinical diagnostic levels and make the quality in the leading place worldwide. Exosomes have been one of the research hotspots in recent years, and the separation technology of exosomes has been constantly updated and improved. After continuous improvement and repeated testing, CUSABIO has also developed high purity, high yield, and high-efficiency exosome isolation kits. CUSABIO now offers a broad range of ELISA kits covering over 6,000 different assay targets and two Cell Supernatant Exosome Isolation Kits.

Antibodies

CUSABIO offers 60,000+ antibodies that are specific to a variety of species and can be used in multiple applications. Furthermore, the number of CUSABIO antibodies is continuing to grow at a rate of 1000 per year.

As an original manufacturer, CUSABIO designs, produces and validates every antibody in-house. Besides advanced experimental apparatus, CUSABIO antibody line also has a professional technical team, so CUSABIO has succeeded in setting up many technology platforms. At present CUSABIO antibodies can be applied in ELISA, WB, IHC/ICC, IF, IP/Co-IP, ChIP and FC. 

Proteins

CUSABIO Protein Expression Platform has established four recombinant expression systems from prokaryotic (E.coli) to eukaryotic (Yeast, mammalian cell and insect baculovirus), and has also built unique in-vitro E.coil expression system, which enables them to express transmembrane proteins that are usually difficult to express.

CUSABIO currently has 70 native proteins, 100 small molecule antigens, 320 active proteins, 1000+ recombinant proteins in stock, 5700+ developed recombinant proteins, 10,000+ cDNA clones, 36,000+ transmembrane proteins, 500,000+ semi-customized recombinant proteins. 

Custom Service

Given the specificity of each experiment, CUSABIO provides the latest and comprehensive custom services to meet their customers request, including phage display service, antibody service, protein service, gene synthesis service and oligo synthesis service. CUSABIO is very pleased to assist their customers worldwide with all passions and great efforts.

www.cusabio.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

Recombinant Zaire ebolavirus Envelope glycoprotein(GP),partial CSB-YP310843ZAA



The add to cart button will appear once you select the values above

Specifications

20ug / 100ug / 500ug price = 100ug

Alternative Name(s):

GP1,2 ;GP

Species: (Organism)

Zaire ebolavirus (strain Eckron-76) (ZEBOV) (Zaire Ebola virus)

Gene Names:

GP

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

EAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYTEGLMHNQNGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVDKTLPD

Expression Region:

502-637aa

Subcellular Location:

GP2: Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein, Note=In the cell, localizes to the plasma membrane lipid rafts, which probably represent the assembly and budding site, SUBCELLULAR LOCATION: GP1: Virion membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Note=GP1 is not anchored to the viral envelope, but forms a disulfid-linked complex with the extravirion surface GP2, In the cell, both GP1 and GP2 localize to the plasma membrane lipid rafts, which probably represent the assembly and budding site, GP1 can also be shed after proteolytic processing, SUBCELLULAR LOCATION: GP2-delta: Secreted

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

17.3 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

GP1 is responsible for binding to the receptor(s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection). Binding to the macrophage specific lectin CLEC10A also seem to enhance virus infectivity. Interaction with FOLR1/folate receptor alpha may be a cofactor for virus entry in some cell types, although results are contradictory. Members of the Tyro3 receptor tyrosine kinase family also seem to be cell entry factors in filovirus infection. Once attached, the virions are internalized through clathrin-dependent endocytosis and/or macropinocytosis. After internalization of the virus into the endosomes of the host cell, proteolysis of GP1 by two cysteine proteases, CTSB/cathepsin B and CTSL/cathepsin L presumably induces a conformational change of GP2, allowing its binding to the host entry receptor NPC1 and unmasking its fusion peptide to initiate membranes fusion.

Involvement in disease:

Relevance:

GP1 is responsible for binding to the receptor(s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection). Binding to the macrophage specific lectin CLEC10A also ses to enhance virus infectivity. Interaction with FOLR1/folate receptor alpha may be a cofactor for virus entry in some cell types, although results are contradictory. Mbers of the Tyro3 receptor tyrosine kinase family also se to be cell entry factors in filovirus infection. Once attached, the virions are internalized through clathrin-dependent endocytosis and/or macropinocytosis. After internalization of the virus into the endosomes of the host cell, proteolysis of GP1 by two cysteine proteases, CTSB/cathepsin B and CTSL/cathepsin L presumably induces a conformational change of GP2, unmasking its fusion peptide and initiating mbranes fusion .GP2 acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell mbrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell mbranes. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the mbrane of the endocytosed virus particle with the endosomal mbrane. Low pH in endosomes induces an irreversible conformational change in GP2, releasing the fusion hydrophobic peptide .GP1,2 mediates endothelial cell activation and decreases endothelial barrier function. Mediates activation of primary macrophages. At terminal stages of the viral infection, when its expression is high, GP1,2 down-modulates the expression of various host cell surface molecules that are essential for immune surveillance and cell adhesion. Down-modulates integrins ITGA1, ITGA2, ITGA3, ITGA4, ITGA5, ITGA6, ITGAV and ITGB1. GP1,2 alters the cellular recycling of the dimer alpha-V/beta-3 via a dynamin-dependent pathway. Decrease in the host cell surface expression of various adhesion molecules may lead to cell detachment, contributing to the disruption of blood vessel integrity and horrhages developed during Ebola virus infection (cytotoxicity). This cytotoxicity appears late in the infection, only after the massive release of viral particles by infected cells. Down-modulation of host MHC-I, leading to altered recognition by immune cells, may explain the immune suppression and inflammatory dysfunction linked to Ebola infection. Also down-modulates EGFR surface expression .GP2delta is part of the complex GP1,2delta released by host ADAM17 metalloprotease. This secreted complex may play a role in the pathogenesis of the virus by efficiently blocking the neutralizing antibodies that would otherwise neutralize the virus surface glycoproteins GP1,2. Might therefore contribute to the lack of inflammatory reaction seen during infection in spite the of extensive necrosis and massive virus production. GP1,2delta does not se to be involved in activation of primary macrophages .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Filoviruses glycoprotein family

Reference:

Emergence of subtype Zaire Ebola virus in Gabon.Volchkov V., Volchkova V., Eckel C., Klenk H.-D., Bouloy M., Leguenno B., Feldmann H.Virology 232:139-144(1997)