Alternative Name(s):

VACWR156; A33RProtein A33

Species: (Organism)

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Gene Names:

VACWR156

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Expression Region:

57-185aa

Subcellular Location:

Virion membrane, Single-pass type II membrane protein, Host membrane, Single-pass type II membrane protein

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

16.2 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Coordinates the incorporation of A36 into wrapped enveloped virion (EV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles.

Involvement in disease:

Relevance:

Coordinates the incorporation of A36 into wrapped enveloped virion membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Chordopoxvirinae A33 protein family

Reference:

"Interactions between vaccinia virus IEV membrane proteins and their roles in IEV assembly and actin tail formation." Rottger S., Frischknecht F., Reckmann I., Smith G.L., Way M. J. Virol. 73:2863-2875(1999)