Recombinant Toxoplasma gondii Profilin(PRF) CSB-YP151074Ba
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
/
Species: (Organism)
Toxoplasma gondii
Gene Names:
PRF
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY
Expression Region:
2-163aa
Subcellular Location:
Tissue Specificity:
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
19.4 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Involvement in disease:
Relevance:
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
A profilin-like protein from Toxoplasma gondii potently triggers dendritic cell IL-12 production through TLR11.Yarovinsky F., Zhang D., Andersen J.F., Bannenberg G.L., Serhan C.N., Hayden M.S., Hieny S., Sutterwala F., Flavell R.A., Ghosh S., Sher A.Skillman K.M., Sibley D. Common inheritance of chromosome Ia associated with clonal expansion of Toxoplasma gondii.Khan A., Bohme U., Kelly K.A., Adlem E., Brooks K., Simmonds M., Mungall K., Quail M.A., Arrowsmith C., Chillingworth T., Churcher C., Harris D., Collins M., Fosker N., Fraser A., Hance Z., Jagels K., Moule S. , Murphy L., O'Neil S., Rajandream M.A., Saunders D., Seeger K., Whitehead S., Mayr T., Xuan X., Watanabe J., Suzuki Y., Wakaguri H., Sugano S., Sugimoto C., Paulsen I., Mackey A.J., Roos D.S., Hall N., Berriman M., Barrell B., Sibley L.D., Ajioka J.W.Genome Res. 16:1119-1125(2006)
