Alternative Name(s):

Short name: TGF-beta-1

Species: (Organism)

Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

Gene Names:

TGFB1

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

QTTTEEICSDKSESCCVRKLYIDFRKDLGWKWIHEPTGYFANYCIGPCTYIWNTENKYSQVLALYKHHNPGASAQPCCVPQVLEPLPIIYYVGRQHKVEQLSNMIVKSCRCS

Expression Region:

271-382aa

Subcellular Location:

Secreted

Tissue Specificity:

Expressed in blood leucocytes, kidney macrophages, brain, gill and spleen but not in liver.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

15 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Likely to be an important cytokine regulating immune response. May also have a role in other physiological systems.

Involvement in disease:

Relevance:

Likely to be an important cytokine regulating immune response. May also have a role in other physiological systems.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

TGF-beta family

Reference:

"Isolation of the first piscine transforming growth factor beta gene: analysis reveals tissue specific expression and a potential regulatory sequence in rainbow trout (Oncorhynchus mykiss)."Hardie L.J., Laing K.J., Daniels G.D., Grabowski P.S., Cunningham C., Secombes C.J.Cytokine 10:555-563(1998)