Alternative Name(s):

Intestinal trefoil factor (hITF) (Polypeptide P1.B) (hP1.B) (ITF) (TFI)

Species: (Organism)

Homo sapiens (Human)

Gene Names:

TFF3

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV

Expression Region:

29-80aa

Subcellular Location:

Secreted, extracellular space, extracellular matrix, Cytoplasm

Tissue Specificity:

Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricular, periventricular and supraoptic nuclei (at protein level).

Protein Length:

Partial

Pathway:

Mol. Weight:

7.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).

Involvement in disease:

Relevance:

Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"The three human trefoil genes TFF1, TFF2, and TFF3 are located within a region of 55 kb on chromosome 21q22.3." Seib T., Blin N., Hilgert K., Seifert M., Theisinger B., Engel M., Dooley S., Zang K.D., Welter C. Genomics 40:200-202(1997)